TCRT5 model (finetuned)
Model description
TCRT5 is a seq2seq model designed to for the conditional generation of T-cell receptor (TCR) sequences given a target peptide-MHC (pMHC). It is a transformers model that is built on the T5 architecture operationalized by the associated HuggingFace abstraction. It is released along with this paper.
Intended uses & limitations
This model is designed for auto-regressively generating CDR3 sequences against a pMHC of interest. This means that the model assumes a plausible pMHC is provided as input. We have not tested the model on peptides and MHC sequences where the binding affinity between petpide-MHC is low and do not expect the model will adjust its predictions around this. This model is intended for academic purposes and should not be used in a clinical setting.
How to use
You can use this model directly for conditional CDR3 generation:
import re
from transformers import T5Tokenizer, T5ForConditionalGeneration
tokenizer = T5Tokenizer.from_pretrained('dkarthikeyan1/tcrt5_ft_tcrdb')
tcrt5 = T5ForConditionalGeneration.from_pretrained("dkarthikeyan1/tcrt5_ft_tcrdb")
pmhc = "[PMHC]KLGGALQAK[SEP]YFAMYQENVAQTDVDTLYIIYRDYTWAELAYTWY[EOS]"
encoded_pmhc = tokenizer(pmhc, return_tensors='pt')
# Define the number of TCRs you would like to generate ()
num_tcrs = 10
# Define the number of beams to explore (recommended: 3x the number of TCRs)
num_beams = 30
outputs = tcrt5.generate(**encoded_pmhc, max_new_tokens=25, num_return_sequences=num_tcrs, num_beams=num_beams, return_dict_in_generate=True)
# Use regex to get out the [TCR] tag
cdr3b_sequences = [re.sub(r'\[.*\]', '', x) for x in tokenizer.batch_decode(outputs['sequences'], skip_special_tokens=True)]
>>> cdr3b_sequences
['CASSLGTGGTDTQYF',
'CASSPGTGGTDTQYF',
'CASSLGQGGTEAFF',
'CASSVGTGGTDTQYF',
'CASSLGTGGSYEQYF',
'CASSPGQGGTEAFF',
'CASSSGTGGTDTQYF',
'CASSLGGGGTDTQYF',
'CASSLGGGSYEQYF',
'CASSLGTGGNQPQHF']
This model can also be used for unconditional generation of CDR3 sequences:
import re
from transformers import T5Tokenizer, T5ForConditionalGeneration
tokenizer = T5Tokenizer.from_pretrained('dkarthikeyan1/tcrt5_ft_tcrdb')
tcrt5 = T5ForConditionalGeneration.from_pretrained("dkarthikeyan1/tcrt5_ft_tcrdb")
# Define the number of TCRs you would like to generate ()
num_tcrs = 10
# Define the number of beams to explore (recommended: 3x the number of TCRs)
num_beams = 30
unconditional_outputs = tcrt5.generate(max_new_tokens=25, num_return_sequences=num_tcrs, num_beams=num_beams, return_dict_in_generate=True)
# Use regex to get out the [TCR] tag
uncond_cdr3b_sequences = [re.sub(r'\[.*\]', '', x) for x in tokenizer.batch_decode(unconditional_outputs['sequences'], skip_special_tokens=True)]
>>> uncond_cdr3b_sequences
['CASSLGGETQYF',
'CASSLGQGNTEAFF',
'CASSLGQGNTGELFF',
'CASSLGTSGTDTQYF',
'CASSLGLAGSYNEQFF',
'CASSLGLAGTDTQYF',
'CASSLGQGYEQYF',
'CASSLGLAGGNTGELFF',
'CASSLGGTGELFF',
'CASSLGQGAYEQYF']
Note: For conditional generation, we found that the model performance was greatest using beam search decoding. However, we also report a reduction in sequence diversity using this particular decoding method. If you would like to generate more diverse sequence, TCRT5 supports a range of alternative decoding strategies which can be found here and here.
Limitations and bias
One of the known biases of TCRT5's predictions is its preference for sampling high V(D)J recombination probability sequences as computed by OLGA. This can be attenuated with the use of alternative decoding methods such as ancestral sampling.
Training data
TCRT5 was pre-trained on masked span reconstruction of ~14M TCR sequences from TCRdb as well as ~740k peptide-pseudosequence pairs taken from IEDB. Finetuning was done using a parallel corpus of ~330k TCR:peptide-pseudosequence pairs taken from VDJdb, IEDB, McPAS, and semi-synthetic examples from MIRA.
Training procedure
Preprocessing
All amino acid sequences, and V/J gene names were standardized using the tidytcells package. See here. MHC
allele information was standardized using mhcgnomes, available here before mapping allele information to the MHC pseudo-sequence
as defined in NetMHCpan.
Pre-training
TCRT5 was pretrained with Masked language modeling (MLM): Span reconstruction similar to the original training loss of the T5 paper. For a given sequence, the model masks 15% of the sequence using contiguous spans of random length from length 1-3. This is done via the sentinel tokens introduced in the T5 paper. Then the entire masked sequence is passed into the model and the model is trained to reconstruct a concatenated sequence comprised of the sentinel tokens followed by the masked tokens. This forces the model to learn richer k-mer dependencies of the masked sequences.
Masks 'mlm_probability' tokens grouped into spans of size 'max_span_length' according to the following algorithm:
* Radnomly generate span lengths that add up to round(mlm_probability*seq_len) (ignoring pad token) for each sequence.
* Ensure that the spans are not directly adjacent to ensure max_span_length is observed
* Once the span masks are generated according to T5 standards mask the inputs and generate the targets
Example Input:
CASSLGQGYEQYF
Masked Input:
CASSLG[X]GY[Y]F
Target:
[X]Q[Y]EQY[Z].
Finetuning
TCRT5 was finetuned on peptide-pseudo sequence -> CDR3 source:target pairs using the canonical cross entropy loss.
Example Input:
[PMHC]KLGGALQAK[SEP]YFAMYQENVAQTDVDTLYIIYRDYTWAELAYTWY[EOS]
Target:
[TCR]CASSLGYNEQFF[EOS].
Results
This fine-tuned model achieves the following results on conditional CDR3 generation on our validation set of the top-20 peptide-MHCs with the most abundant known TCRs (in alphabetical order):
- AVFDRKSDAK_A*11:01
- CRVRLCCYVL_C*07:02
- EAAGIGILTV_A*02:01
- ELAGIGILTV_A*02:01
- GILGFVFTL_A*02:01
- GLCTLVAML_A*02:01
- IVTDFSVIK_A*11:01
- KLGGALQAK_A*03:01
- LLLDRLNQL_A*02:01
- LLWNGPMAV_A*02:01
- LPRRSGAAGA_B*07:02
- LVVDFSQFSR_A*11:01
- NLVPMVATV_A*02:01
- RAKFKQLL_B*08:01
- SPRWYFYYL_B*07:02
- STLPETAAVRR_A*11:01
- TPRVTGGGAM_B*07:02
- TTDPSFLGRY_A*01:01
- YLQPRTFLL_A*02:01
- YVLDHLIVV_A*02:01
Benchmark results:
| Metric | Char-BLEU | F@100 | SeqRec% | Diversity (num_seq) | Ave. Jaccard Dissimilarity | Perplexity |
|---|---|---|---|---|---|---|
| 96.4 | .09 | 89.2 | 1300 (2000 max) | 94.4/100 | 2.48 |
BibTeX entry and citation info
@Article{Karthikeyan2025_tcrtranslate,
author={Karthikeyan, Dhuvarakesh
and Bennett, Sarah N.
and Reynolds, Amy G.
and Vincent, Benjamin G.
and Rubinsteyn, Alex},
title={Conditional generation of real antigen-specific T cell receptor sequences},
journal={Nature Machine Intelligence},
year={2025},
month={Sep},
day={08},
abstract={Despite recent advances in T cell receptor (TCR) engineering, designing functional TCRs against arbitrary targets remains challenging due to complex rules governing cross-reactivity and limited paired data. Here we present TCR-TRANSLATE, a sequence-to-sequence framework that adapts low-resource machine translation techniques to generate antigen-specific TCR sequences against unseen epitopes. By evaluating 12 model variants of the BART and T5 model architectures, we identified key factors affecting performance and utility, revealing discordances between these objectives. Our flagship model, TCRT5, outperforms existing approaches on computational benchmarks, prioritizing functionally relevant sequences at higher ranks. Most significantly, we experimentally validated a computationally designed TCR against Wilms' tumour antigen, a therapeutically relevant target in leukaemia, excluded from our training and validation sets. Although the identified TCR shows cross-reactivity with pathogen-derived peptides, highlighting limitations in specificity, our work represents the successful computational design of a functional TCR construct against a non-viral epitope from the target sequence alone. Our findings establish a foundation for computational TCR design and reveal current limitations in data availability and methodology, providing a framework for accelerating personalized immunotherapy by reducing the search space for novel targets.},
issn={2522-5839},
doi={10.1038/s42256-025-01096-6},
url={https://doi.org/10.1038/s42256-025-01096-6}
}
- Downloads last month
- 1,083
Model tree for dkarthikeyan1/tcrt5_ft_tcrdb
Base model
dkarthikeyan1/tcrt5_pre_tcrdb